Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Soy Braised Eggplant

Silky eggplant cooked until tender in a glossy garlic-soy sauce that clings to every piece. One skillet, 18 minutes, umami-packed and dangerously easy.

Total time
18 min
Servings
2
Calories
187
Protein
2g
Garlic Soy Braised Eggplant
comfortwholesomechinesevegetarianvegandairy-freevegetariansilky

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until shimmering, about 1 minute.

  2. Step 2

    Add eggplant chunks and stir occasionally until edges are golden, about 5 minutes.

  3. Step 3

    Push eggplant to the sides, add garlic to the center, and cook until fragrant, 30 seconds.

  4. Step 4

    Stir soy sauce, rice vinegar, and sugar into a splash of water, then pour into the skillet.

  5. Step 5

    Cover and simmer until eggplant is completely tender and sauce clings glossy, about 8 minutes.

  6. Step 6

    Serve hot, spooning the glossy sauce over each portion.

Tools you’ll need

  • large skillet or wok (12-inch)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.