Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlicky Glazed Eggplant

Silky eggplant braised in a savory-sweet garlic sauce until tender and glossy. Ready in under 20 minutes, no fuss, pure TikTok magic.

Total time
18 min
Servings
2
Calories
145
Protein
2g
Garlicky Glazed Eggplant
comfortsimplechinesevegetarianvegansilkytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Place eggplant cut-side down in the hot skillet and sear 4 minutes until the surface turns golden and begins to soften.

  3. Step 3

    Flip eggplant skin-side down. Add minced garlic to the pan and stir for 30 seconds until fragrant.

  4. Step 4

    Pour in soy sauce, vinegar, sugar, and 1/4 cup water. Bring to a simmer and braise for 6 minutes until eggplant is very tender.

  5. Step 5

    Tilt the skillet and spoon the glossy sauce over the eggplant. Transfer to a plate and pour all sauce on top.

Tools you’ll need

  • large skillet or sauté pan (12-inch)
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.