Gochujang Buttered Noodles
Pasta tossed with a silky, spicy gochujang-butter sauce spiked with garlic. Ready in 15 minutes, dangerously addictive, and proof that four ingredients can slap.
- Total time
- 15 min
- Servings
- 2
- Calories
- 410
- Protein
- 12g

comfortquickkoreanvegetariancreamytenderweeknightpasta
Ingredients
- 8 oz spaghetti or linguine
- 3 tbsp gochujang
- 3 tbsp butter
- 3 cloves garlic, minced
Instructions
- 1
Boil salted water in a large skillet or pot, then cook pasta until al dente.
- 2
Reserve 1 cup pasta water, then drain the pasta.
- 3
Return the skillet to medium heat and melt butter, then cook garlic for 30 seconds until fragrant.
- 4
Stir in gochujang until smooth, then add the cooked pasta and toss.
- 5
Add pasta water a splash at a time until the sauce coats the noodles with a silky gloss.
- 6
Season with salt and pepper, then serve hot.
Tools you’ll need
- large skillet or pot
- colander
- spoon or tongs
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



