Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Gochujang Buttered Noodles

Pasta tossed with a silky, spicy gochujang-butter sauce spiked with garlic. Ready in 15 minutes, dangerously addictive, and proof that four ingredients can slap.

Total time
15 min
Servings
2
Calories
410
Protein
12g
Gochujang Buttered Noodles
comfortquickkoreanvegetariancreamytenderweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet or pot, then cook pasta until al dente.

  2. Step 2

    Reserve 1 cup pasta water, then drain the pasta.

  3. Step 3

    Return the skillet to medium heat and melt butter, then cook garlic for 30 seconds until fragrant.

  4. Step 4

    Stir in gochujang until smooth, then add the cooked pasta and toss.

  5. Step 5

    Add pasta water a splash at a time until the sauce coats the noodles with a silky gloss.

  6. Step 6

    Season with salt and pepper, then serve hot.

Tools you’ll need

  • large skillet or pot
  • colander
  • spoon or tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.