Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Loaded Korean Ramyeon with Egg & Crispy Toppings

A viral-worthy ramyeon bowl loaded with a soft-boiled egg, crispy fried onions, fresh greens, and a spicy gochujang broth. Total cook time under 15 minutes — pure TikTok energy.

Total time
15 min
Servings
2
Calories
385
Protein
12g
Loaded Korean Ramyeon with Egg & Crispy Toppings
comfortquickkoreaneggscrispytendercreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring water to a boil in a large pot over high heat.

  2. Step 2

    While water heats, whisk gochujang, soy sauce, and minced garlic in a small bowl until smooth.

  3. Step 3

    Once water boils, add ramyeon noodles and cook for 3 minutes, stirring to separate.

  4. Step 4

    Stir gochujang mixture into the pot, then crack both eggs directly into the broth and let simmer until whites set, ~2 minutes.

  5. Step 5

    Divide noodles and broth between 2 bowls, placing one egg in each.

  6. Step 6

    Top with crispy fried onions and sliced scallion, then serve immediately.

Tools you’ll need

  • large pot (at least 3-quart capacity)
  • small mixing bowl
  • whisk
  • wooden spoon or chopsticks
  • soup ladle or slotted spoon
  • two soup bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.