Golden Corn Fritters
Crispy corn fritters loaded with fresh scallions—fried until golden and crunchy outside. Ready in 20 minutes with just flour, egg, and corn from your kitchen.
- Total time
- 20 min
- Servings
- 2
- Calories
- 240
- Protein
- 5g

casualcomfortamericanvegetariancrispytenderweeknightappetizer
Ingredients
- 1.5 cups fresh or frozen corn
- ½ cup flour
- 1 whole egg
- 2 whole scallion, chopped
Instructions
- 1
Mix corn, flour, egg, scallion, 0.5 tsp salt, and 0.25 tsp pepper in a bowl until combined.
- 2
Heat 0.5 inch oil in a 10-inch skillet over medium-high until a drop of batter sizzles immediately.
- 3
Scoop batter into 2-tbsp portions and drop into hot oil, flattening slightly with a spoon.
- 4
Fry 2 to 3 minutes per side until golden brown and crispy edges curl away from the pan.
- 5
Transfer to a paper-towel-lined plate and serve hot.
Tools you’ll need
- 10-inch skillet
- mixing bowl
- spoon
- paper towels
- instant-read thermometer (optional, for verifying oil temp ~350°F)
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



