CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Golden Corn Fritters

Crispy corn fritters loaded with fresh scallions—fried until golden and crunchy outside. Ready in 20 minutes with just flour, egg, and corn from your kitchen.

Total time
20 min
Servings
2
Calories
240
Protein
5g
Golden Corn Fritters
casualcomfortamericanvegetariancrispytenderweeknightappetizer

Ingredients

  • 1.5 cups fresh or frozen corn
  • ½ cup flour
  • 1 whole egg
  • 2 whole scallion, chopped

Instructions

  1. 1

    Mix corn, flour, egg, scallion, 0.5 tsp salt, and 0.25 tsp pepper in a bowl until combined.

  2. 2

    Heat 0.5 inch oil in a 10-inch skillet over medium-high until a drop of batter sizzles immediately.

  3. 3

    Scoop batter into 2-tbsp portions and drop into hot oil, flattening slightly with a spoon.

  4. 4

    Fry 2 to 3 minutes per side until golden brown and crispy edges curl away from the pan.

  5. 5

    Transfer to a paper-towel-lined plate and serve hot.

Tools you’ll need

  • 10-inch skillet
  • mixing bowl
  • spoon
  • paper towels
  • instant-read thermometer (optional, for verifying oil temp ~350°F)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.