Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Golden Waffles with Maple Syrup

Crispy-edged, fluffy waffles made from four staple ingredients and served with melted butter and warm maple syrup. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
380
Protein
7g
Golden Waffles with Maple Syrup
comfortcozyamericanvegetarianeggscrispyfluffyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, milk, egg, melted butter, salt, and pepper in a bowl until no lumps remain.

  2. Step 2

    Heat waffle iron until water droplets sizzle and evaporate on contact, ~3 minutes.

  3. Step 3

    Pour batter into the iron, close lid, and cook until golden brown and steam stops, ~4 minutes.

  4. Step 4

    Slide waffle onto a plate and repeat with remaining batter.

  5. Step 5

    Top with butter and warm maple syrup, then serve immediately.

Tools you’ll need

  • waffle iron
  • large mixing bowl
  • whisk
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.