Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Minute Greek Chicken Bowl

Pan-seared chicken breast over rice with cool cucumber and creamy tzatziki. Ready in 15 minutes with four simple ingredients.

Total time
15 min
Servings
2
Calories
420
Protein
38g
15-Minute Greek Chicken Bowl
lightfreshgreekchickentendercrispyweeknightbowl

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry with paper towels. Season both sides generously with salt and black pepper.

  2. Step 2

    Heat 1 tbsp oil in a skillet over medium-high until shimmering. Sear chicken 5–6 minutes per side until golden and cooked through. Transfer to a plate and rest 2 minutes, then slice.

  3. Step 3

    Warm rice if needed: microwave in a covered bowl 1–2 minutes, or use room-temperature cooked rice.

  4. Step 4

    Divide rice between two bowls. Top with sliced chicken, diced cucumber, and a generous dollop of tzatziki. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • cutting board
  • knife
  • two bowls
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.