Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Greek Fisherman's Broth

Kakavia is a rustic Greek seafood soup built on tomato broth with white fish and shrimp. This weeknight version skips the long simmer — just a bright, briny bowl ready in 20 minutes.

Total time
20 min
Servings
4
Calories
220
Protein
32g
20-Min Greek Fisherman's Broth
comfortlightgreekmediterraneanfishshrimptendersilky

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring stock to a boil in a large pot over medium-high heat.

  2. Step 2

    Add tomatoes, lemon zest, salt, and pepper. Simmer 5 minutes until flavors meld.

  3. Step 3

    Cut fish into 2-inch chunks. Add to pot and simmer 4 minutes without stirring.

  4. Step 4

    Add shrimp and olives. Simmer until shrimp turns opaque and fish flakes easily, 3 minutes.

  5. Step 5

    Squeeze lemon juice into pot. Taste and season with salt and pepper.

  6. Step 6

    Ladle into bowls. Garnish with fresh oregano or parsley. Serve hot.

Tools you’ll need

  • large pot (6+ quart capacity)
  • cutting board
  • chef's knife
  • wooden spoon
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.