Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

2-Ingredient Greek Yogurt Bagels

Fluffy bagels made with just Greek yogurt and self-rising flour—no yeast, no overnight rise. Boil and bake them in 20 minutes for a chewy, tender breakfast.

Total time
20 min
Servings
4
Calories
210
Protein
8g
2-Ingredient Greek Yogurt Bagels
quicksimpleamericanvegetarianchewyfluffyweeknightbreakfast

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix Greek yogurt, self-rising flour, and salt in a bowl until a soft dough forms.

  2. Step 2

    Divide dough into 4 balls, then roll each into a 6-inch rope and pinch the ends to seal into a ring.

  3. Step 3

    Bring a pot of salted water to a boil, then drop bagels in and remove them as soon as they float.

  4. Step 4

    Place bagels on a lined baking sheet, brush lightly with water, and bake at 400°F for 12 minutes until golden.

  5. Step 5

    Cool for 2 minutes, then slice and serve warm with your favorite toppings.

Tools you’ll need

  • mixing bowl
  • large pot
  • baking sheet
  • parchment paper

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.