Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Cheese

Crispy golden bread, melted cheese, and buttery edges—the ultimate comfort sandwich. Ready in 10 minutes with just four ingredients.

Total time
10 min
Servings
1
Calories
380
Protein
14g
Grilled Cheese
comfortcasualamericanvegetariancrispymeltyweeknightlunch

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Butter one side of each bread slice generously.

  2. Step 2

    Heat a skillet over medium heat until a drop of water sizzles on contact.

  3. Step 3

    Place one slice butter-side down in the pan. Layer cheese on top.

  4. Step 4

    Top with second slice, butter-side up. Cook until bottom is golden brown, ~3 minutes.

  5. Step 5

    Flip carefully. Cook until second side is golden and cheese melts completely, ~2 minutes.

  6. Step 6

    Remove to a plate. Season with salt and pepper if desired. Serve immediately.

Tools you’ll need

  • 8-10 inch skillet or griddle
  • spatula
  • butter knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.