Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Cheese with Bacon Crumble and Creamy Sauce

A crispy grilled cheese sandwich topped with crunchy bacon crumble and a rich, creamy sauce. Perfect for a comforting weeknight dinner.

Total time
25 min
Servings
2
Calories
650
Protein
22g
Grilled Cheese with Bacon Crumble and Creamy Sauce
comfortingamericanporkcheesecrispycreamyweeknightsandwich

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook the 4 bacon slices in a skillet over medium heat until crispy, about 6-8 minutes. Transfer to a paper towel-lined plate, then crumble when cool enough to handle.

  2. Step 2

    In a small saucepan, melt 1 tbsp butter over medium heat. Whisk in 1 tbsp flour and cook for 1 minute until bubbly.

  3. Step 3

    Gradually whisk in 0.5 cup heavy cream, 0.25 tsp salt, and 0.25 tsp black pepper. Simmer until thickened, about 2-3 minutes. Set aside.

  4. Step 4

    Spread the remaining 1 tbsp butter on one side of each bread slice. Place 2 slices buttered-side down in a skillet over medium heat.

  5. Step 5

    Top each with 2 oz cheddar cheese and the other bread slice, buttered-side up. Cook until golden brown and cheese melts, about 3-4 minutes per side.

  6. Step 6

    Slice each sandwich in half, drizzle with the creamy sauce, and sprinkle with the bacon crumble. Serve warm.

Tools you’ll need

  • skillet
  • small saucepan
  • whisk
  • spatula
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.