Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Tsipoura with Lemon & Oregano

Whole Mediterranean sea bream, simply seasoned and grilled until skin crisps and flesh turns opaque. A Greek island classic ready in 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
48g
Grilled Tsipoura with Lemon & Oregano
freshsimpleelegantgreekfishcrispytenderjuicy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat tsipoura dry inside and out with paper towels. Score skin diagonally 3 times on each side.

  2. Step 2

    Brush fish inside cavity and both sides generously with olive oil.

  3. Step 3

    Season cavities and both sides with salt, pepper, and oregano. Stuff each cavity with lemon half.

  4. Step 4

    Preheat grill to medium-high. Oil the grates with a folded oiled paper towel.

  5. Step 5

    Place tsipoura on hot grates. Grill without moving for 6–7 minutes until skin is charred and crispy.

  6. Step 6

    Flip carefully. Grill the second side 5–6 minutes until flesh flakes easily at the thickest part.

  7. Step 7

    Transfer to a serving platter. Drizzle with any pan juices. Serve hot with lemon wedges.

Tools you’ll need

  • charcoal or gas grill
  • long-handled tongs
  • paper towels
  • pastry brush
  • knife for scoring
  • serving platter

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.