Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Tsipura with Lemon & Herbs

Whole Mediterranean sea bream grilled until the skin crisps and flesh stays tender, finished with a squeeze of fresh lemon and a drizzle of quality olive oil. Restaurant-quality in 20 minutes.

Total time
20 min
Servings
2
Calories
380
Protein
42g
Grilled Tsipura with Lemon & Herbs
elegantsimplegreekmediterraneanfishcrispytenderjuicy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the fish dry inside and out with paper towels. Stuff each cavity with lemon slices, herb sprigs, and crushed garlic.

  2. Step 2

    Rub the exterior generously with olive oil, then season all over with salt and black pepper.

  3. Step 3

    Heat a grill or grill pan over medium-high until a drop of water sizzles on contact, about 2 minutes.

  4. Step 4

    Lay the fish on the grill without moving. Cook 7–8 minutes until the skin is charred and crispy.

  5. Step 5

    Flip gently and cook the other side 6–7 minutes until the flesh flakes at the thickest point near the spine.

  6. Step 6

    Transfer to a plate, squeeze fresh lemon juice over the top, and drizzle with best-quality olive oil. Serve immediately.

Tools you’ll need

  • grill or grill pan
  • paper towels
  • tongs or fish spatula
  • cutting board
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.