Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Veggie Hummus Wrap with Tahini Drizzle

Warm tortillas loaded with store-bought hummus, char-grilled zucchini and bell peppers, crisp greens, and a drizzle of tahini-lemon sauce. Ready in under 15 minutes—weeknight Mediterranean comfort food.

Total time
15 min
Servings
2
Calories
380
Protein
13g
Grilled Veggie Hummus Wrap with Tahini Drizzle
freshquickcasualmediterraneanvegetarianveganchickpeascrispy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a grill pan or skillet over medium-high heat until hot, about 1 minute.

  2. Step 2

    Brush zucchini and bell pepper with oil, salt, and pepper. Grill 2-3 minutes per side until charred and tender.

  3. Step 3

    Warm tortillas directly over the flame (or in the skillet 30 seconds per side) until pliable.

  4. Step 4

    Whisk tahini and lemon juice with 1 tbsp water until smooth; season with salt and pepper.

  5. Step 5

    Spread 3 tbsp hummus on each tortilla, then layer spinach, grilled vegetables, and extra veggies if desired.

  6. Step 6

    Drizzle tahini sauce over filling, roll tightly, cut in half, and serve immediately with extra sauce on the side.

Tools you’ll need

  • grill pan or 12-inch skillet
  • pastry brush
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.