Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Halawet El Jibn (Cheese Pastry)

Stretchy white cheese rolled in crispy pastry sheets, drizzled with hot syrup and scattered with nuts. This Lebanese dessert takes 25 minutes and feels like pure indulgence.

Total time
25 min
Servings
4
Calories
320
Protein
8g
Halawet El Jibn (Cheese Pastry)
indulgentlebanesemiddle-easternvegetariancrispymeltydessertweekend

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Stir sugar, water, and rose water in a small saucepan over medium heat until sugar dissolves, ~3 minutes. Pour into a bowl to cool.

  2. Step 2

    Cut mozzarella into thin sticks about 3 inches long. Pat dry with paper towels.

  3. Step 3

    Lay one phyllo sheet flat. Brush lightly with melted butter. Place a cheese stick at one edge, roll tightly, then fold in the sides like a burrito.

  4. Step 4

    Heat 2 tbsp butter in a large skillet over medium-high heat. Fry rolls 1-2 minutes per side until golden and crispy.

  5. Step 5

    Immediately transfer to a plate and drizzle generously with cooled syrup. Scatter chopped nuts on top and serve warm.

Tools you’ll need

  • small saucepan
  • large skillet
  • paper towels
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.