Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Harajuku Crepes with Nutella and Fresh Fruit

Paper-thin Japanese crepes filled with Nutella, fresh berries, and whipped cream, then drizzled with condensed milk. Sweet, indulgent, and Instagram-worthy in under an hour.

Total time
45 min
Servings
2
Calories
582
Protein
9g
Harajuku Crepes with Nutella and Fresh Fruit
indulgentelegantjapanesevegetariancrispycreamyfluffydate-night

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, milk, eggs, melted butter, and pinch of salt until smooth.

  2. Step 2

    Strain batter through a fine sieve into a clean bowl. Let rest 15 minutes.

  3. Step 3

    Whip heavy cream with 1 tbsp powdered sugar until soft peaks form.

  4. Step 4

    Slice strawberries in half. Pat berries dry with paper towels.

  5. Step 5

    Heat an 8-inch nonstick skillet over medium-high until a water drop sizzles.

  6. Step 6

    Pour 3 tbsp batter in center. Immediately tilt skillet in circular motion to spread thin.

  7. Step 7

    Cook 60 seconds until underside is pale gold, then slide onto a plate.

  8. Step 8

    Repeat with remaining batter. You should have 4 crepes total.

  9. Step 9

    Spread 2 tbsp Nutella across the lower half of a crepe, leaving 1-inch border.

  10. Step 10

    Add a spoonful of whipped cream and a handful of berries on top of Nutella.

  11. Step 11

    Fold crepe in half, then in half again to form a triangle.

  12. Step 12

    Repeat with remaining crepes, then drizzle all with condensed milk.

  13. Step 13

    Dust with remaining powdered sugar and serve immediately.

Tools you’ll need

  • whisk
  • 8-inch nonstick skillet
  • fine sieve
  • electric mixer or whisk
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.