Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Harajuku Strawberry Crepes

Sweet Japanese-style crepes filled with whipped cream and fresh strawberries, topped with chocolate sauce and condensed milk drizzle. Ready in 30 minutes with a tender, delicate finish.

Total time
30 min
Servings
4
Calories
480
Protein
8g
Harajuku Strawberry Crepes
indulgentelegantjapanesevegetariancreamytenderfluffyweekend

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, eggs, and milk in a bowl until smooth. Stir in melted butter.

  2. Step 2

    Let batter rest 10 minutes at room temperature for tender crepes.

  3. Step 3

    Heat a 9-inch non-stick skillet over medium until a water droplet sizzles.

  4. Step 4

    Pour 1/4 cup batter into skillet, tilting to spread evenly. Cook until bottom is light tan, ~60 seconds.

  5. Step 5

    Flip crepe. Cook the other side until edges curl slightly, ~30 seconds. Slide onto a plate.

  6. Step 6

    Repeat with remaining batter, stacking finished crepes on the plate.

  7. Step 7

    Whip cream with 1 tbsp sugar until soft peaks form, ~2 minutes.

  8. Step 8

    Lay a crepe flat. Spread 2 tbsp whipped cream down the center.

  9. Step 9

    Top cream with a handful of strawberry slices. Fold crepe in half.

  10. Step 10

    Drizzle with condensed milk and chocolate sauce. Serve immediately.

Tools you’ll need

  • 9-inch non-stick skillet
  • large mixing bowl
  • whisk
  • rubber spatula
  • electric mixer or whisk
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.