CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Harajuku Strawberry Crepes

Sweet Japanese-style crepes filled with whipped cream and fresh strawberries, topped with chocolate sauce and condensed milk drizzle. Ready in 30 minutes with a tender, delicate finish.

Total time
30 min
Servings
4
Calories
480
Protein
8g
Harajuku Strawberry Crepes
indulgentelegantjapanesevegetariancreamytenderfluffyweekend

Ingredients

  • 1 cup all-purpose flour
  • 2 whole eggs
  • 1.25 cups whole milk
  • 3 tbsp butter, melted
  • 1 lb fresh strawberries, hulled and sliced
  • ½ cup heavy whipping cream
  • ½ cup combined sweetened condensed milk + chocolate sauce (for topping)

Instructions

  1. 1

    Whisk flour, eggs, and milk in a bowl until smooth. Stir in melted butter.

  2. 2

    Let batter rest 10 minutes at room temperature for tender crepes.

  3. 3

    Heat a 9-inch non-stick skillet over medium until a water droplet sizzles.

  4. 4

    Pour 1/4 cup batter into skillet, tilting to spread evenly. Cook until bottom is light tan, ~60 seconds.

  5. 5

    Flip crepe. Cook the other side until edges curl slightly, ~30 seconds. Slide onto a plate.

  6. 6

    Repeat with remaining batter, stacking finished crepes on the plate.

  7. 7

    Whip cream with 1 tbsp sugar until soft peaks form, ~2 minutes.

  8. 8

    Lay a crepe flat. Spread 2 tbsp whipped cream down the center.

  9. 9

    Top cream with a handful of strawberry slices. Fold crepe in half.

  10. 10

    Drizzle with condensed milk and chocolate sauce. Serve immediately.

Tools you’ll need

  • 9-inch non-stick skillet
  • large mixing bowl
  • whisk
  • rubber spatula
  • electric mixer or whisk
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.