Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Harissa Fish with Rice & Roasted Sides

Spiced harissa-roasted fish fillet with fluffy seasoned rice, roasted sweet potato wedges, and bitter melon—all prepped on one sheet pan for a warming Moroccan dinner.

Total time
28 min
Servings
2
Calories
520
Protein
38g
Harissa Fish with Rice & Roasted Sides
comfortheartymoroccanfishtendercrispyweeknightdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Start rice in a pot with 2 cups salted water. Bring to boil, then cover and reduce heat to low.

  2. Step 2

    Toss sweet potato wedges and bitter melon halves with 2 tbsp oil, salt, and pepper. Spread on a large sheet pan.

  3. Step 3

    Roast vegetables at 425°F for 12 minutes until sweet potato begins to soften.

  4. Step 4

    Pat fish dry. Mix harissa with 1 tbsp oil and a pinch of salt. Coat both sides of fillets.

  5. Step 5

    Push roasted vegetables to the sides of the pan. Lay fish in the center, scatter bell pepper strips around it.

  6. Step 6

    Roast 10–12 minutes more until fish flakes easily and edges of vegetables crisp.

  7. Step 7

    Toast cumin seeds in a dry skillet 30 seconds, then stir into cooked rice. Squeeze lemon over fish.

  8. Step 8

    Plate rice, fish, and roasted vegetables together. Serve immediately.

Tools you’ll need

  • medium pot with lid
  • large sheet pan (13×18 inch)
  • small skillet
  • cutting board
  • knife
  • measuring spoons
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.