Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Hawaiian Saimin with Egg & Bok Choy

Silky ramen noodles in a light dashi-inspired broth, topped with a crispy fried egg and tender bok choy. A 15-minute weeknight dinner that tastes like island comfort.

Total time
15 min
Servings
2
Calories
385
Protein
12g
Hawaiian Saimin with Egg & Bok Choy
comfortsimplehawaiianeggssilkytendercrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring water to a boil in a large pot over high heat, then whisk in dashi powder and soy sauce.

  2. Step 2

    Add ramen noodles and bok choy. Simmer until noodles are tender and bok choy is just wilted, ~4 minutes.

  3. Step 3

    While noodles cook, heat 2 tbsp oil in a skillet over medium-high until shimmering.

  4. Step 4

    Crack eggs into the skillet. Fry until whites set but yolks jiggle, ~3 minutes.

  5. Step 5

    Ladle noodles and broth into bowls, then top each with a fried egg.

Tools you’ll need

  • large pot
  • whisk
  • 12-inch skillet
  • ladle
  • chopsticks or tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.