Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Shrimp Mohinga

Silky chickpea-flour broth loaded with tender shrimp, finished with crispy fried shallots and a squeeze of lime. A streamlined Burmese noodle soup that tastes like you've been simmering it all day.

Total time
20 min
Servings
2
Calories
285
Protein
28g
20-Min Shrimp Mohinga
comfortcozyburmeseshrimpsilkytendercrispyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring 4 cups water to a boil in a large pot over medium-high heat.

  2. Step 2

    Whisk chickpea flour with 0.5 cup cold water until smooth, then slowly pour into boiling water while stirring constantly to avoid lumps.

  3. Step 3

    Add ginger, fish sauce, and tamarind paste. Stir and simmer for 5 minutes until the broth turns silky and darkens slightly.

  4. Step 4

    Add shrimp and cook until they turn pink and curl, about 3 minutes. Taste and adjust seasoning with salt or fish sauce.

  5. Step 5

    Divide noodles or rice between bowls, pour broth and shrimp over top, and scatter fried shallots on each.

  6. Step 6

    Squeeze lime wedge over the bowl and serve immediately.

Tools you’ll need

  • large pot (4-quart minimum)
  • whisk
  • wooden spoon
  • bowls (2)
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.