Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Homemade Mochi with Kinako & Red Bean

Pillowy mochi made from scratch in 20 minutes, dusted with nutty kinako powder and filled with sweet red bean paste. A stunning TikTok-worthy Japanese rice cake that tastes like a dessert but comes together faster than you'd think.

Total time
20 min
Servings
4
Calories
185
Protein
3g
Homemade Mochi with Kinako & Red Bean
elegantindulgentjapanesevegetariandairy-freechewyfluffysoft

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix sweet rice flour, sugar, and salt in a microwave-safe bowl. Whisk in water until completely smooth.

  2. Step 2

    Cover bowl loosely with plastic wrap. Microwave on high for 2 minutes, stir, then microwave another 1-2 minutes until the dough is translucent and glossy.

  3. Step 3

    Dust a work surface generously with potato starch. Pour hot mochi dough onto the starch and let cool for 1 minute until you can handle it.

  4. Step 4

    Divide mochi into 8 equal pieces. Flatten each piece, spoon 1.5 teaspoons of red bean paste into the center, then fold edges up and seal gently.

  5. Step 5

    Roll each filled mochi ball lightly in potato starch to coat all sides, shaking off excess.

  6. Step 6

    Arrange mochi on a serving plate and dust generously with kinako powder just before serving.

Tools you’ll need

  • microwave-safe bowl
  • whisk
  • plastic wrap
  • microwave
  • work surface or cutting board
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.