Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Honey-Glazed Chicken Thighs

Vietnamese-inspired chicken thighs glazed with honey, fish sauce, and garlic, caramelized in a skillet in 25 minutes. Sticky, savory-sweet, and perfect over rice.

Total time
25 min
Servings
4
Calories
285
Protein
32g
Honey-Glazed Chicken Thighs
satisfyingsimplevietnamesechickenjuicycaramelizedweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry with paper towels. Season both sides generously with salt and black pepper.

  2. Step 2

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Sear chicken thighs 4–5 minutes per side without moving until golden brown. Transfer to a plate.

  4. Step 4

    Add minced garlic to the same skillet. Cook 30 seconds until fragrant, stirring constantly.

  5. Step 5

    Whisk in honey and fish sauce. Return chicken to the skillet and turn to coat. Simmer 6–8 minutes until glaze thickens and clings to chicken.

  6. Step 6

    Squeeze lime over the top. Serve immediately over rice, with extra glaze spooned over.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • cutting board
  • knife
  • wooden spoon
  • small whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.