Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Huaraches de Suadero

Crispy, oblong masa boats topped with tender braised beef suadero, beans, and fresh garnishes. A street-food classic that's faster than you'd expect when using quick-braised beef shoulder.

Total time
55 min
Servings
4
Calories
620
Protein
38g
Huaraches de Suadero
comfortcasualmexicanbeefcrispytenderweeknightdinner

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place beef chunks, onion half, and garlic cloves in a pot. Cover with water, add salt and pepper, and bring to a boil over high heat.

  2. Step 2

    Reduce heat to medium-low and simmer, partially covered, until beef is very tender and shreds easily, ~35 minutes.

  3. Step 3

    Drain beef, discard aromatics, and shred meat with two forks. Season with salt and pepper; set aside.

  4. Step 4

    Mix masa harina with warm water until a soft, pliable dough forms, like Play-Doh. Rest 5 minutes.

  5. Step 5

    Divide dough into 8 portions. Roll each into a ball, then flatten and stretch into a 5-inch oblong boat shape with slightly raised edges.

  6. Step 6

    Heat 0.5 inch of oil in a large skillet over medium-high until a pinch of dough sizzles immediately when dropped in.

  7. Step 7

    Fry huaraches 2–3 at a time, 2 minutes per side, until golden and crispy. Drain on paper towels.

  8. Step 8

    Warm refried beans in a small skillet over medium heat, stirring often, ~2 minutes.

  9. Step 9

    Spread a thin layer of warm beans onto each huarache, then top with shredded suadero.

  10. Step 10

    Sprinkle cheese over the beef and serve immediately with cilantro, cabbage, and lime wedges on the side.

Tools you’ll need

  • large pot with lid
  • two forks
  • bowl
  • 12-inch skillet
  • paper towels
  • small skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.