Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Huli Huli Chicken

Sweet-savory Hawaiian grilled chicken with a signature caramelized glaze of pineapple, soy, and ginger. Charred outside, juicy inside—ready in 40 minutes.

Total time
40 min
Servings
4
Calories
420
Protein
38g
Huli Huli Chicken
casualsatisfyinghawaiianchickencrispyjuicytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine pineapple juice, soy sauce, ginger, garlic, brown sugar, and vinegar in a small saucepan.

  2. Step 2

    Bring to a boil, then reduce to low heat and simmer until syrupy, about 8 minutes.

  3. Step 3

    Remove from heat and let cool slightly. Reserve 3 tbsp for serving.

  4. Step 4

    Pat chicken dry and season with salt and pepper. Brush with olive oil on all sides.

  5. Step 5

    Heat a grill or cast iron skillet to medium-high heat until very hot, about 2 minutes.

  6. Step 6

    Place chicken skin-side down on the grill. Do not move for 5 minutes—skin should be deeply golden.

  7. Step 7

    Flip chicken. Brush the cooked side generously with glaze, then grill 4 more minutes.

  8. Step 8

    Flip again, brush the second side with glaze, and grill 3 minutes until internal temperature reaches 165°F.

  9. Step 9

    Transfer to a platter. Drizzle with reserved glaze and serve immediately.

Tools you’ll need

  • small saucepan
  • grill or 12-inch cast iron skillet
  • meat thermometer
  • brush or tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.