CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Hungarian Apple Flódni

A rustic Hungarian pastry with layers of apple filling, walnut crumble, and apricot jam, baked until golden. Simple, showstopping, and surprisingly approachable for home bakers.

Total time
50 min
Servings
8
Calories
328
Protein
5g
Hungarian Apple Flódni
cozyrustichungarianvegetariancrispyflakytenderweekend

Ingredients

  • 2 cups all-purpose flour
  • 6 tablespoons unsalted butter, softened
  • ½ cup apricot jam
  • 4 whole apples, medium
  • ¾ cup walnuts, chopped
  • ⅓ cup sugar (divided: 1/4 cup for filling, 2 tablespoons for crumble)
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Preheat the oven to 375°F and wait for the indicator light or beep to show it is fully heated, about 10 minutes.

  2. 2

    In a medium bowl, mix the softened butter and flour together using your fingers until the mixture resembles coarse breadcrumbs or wet sand.

  3. 3

    Peel each apple by scrubbing away the skin with a vegetable peeler or sharp knife, working from the stem end toward the opposite end.

  4. 4

    Cut each peeled apple in half lengthwise from stem to bottom, then scoop out the core and seeds using a small spoon, creating a hollow cavity.

  5. 5

    Place each apple half cut-side down on the cutting board and slice crosswise into thin pieces the thickness of a coin, creating thin apple slices.

  6. 6

    In a small bowl, mix the apple slices with 1/4 cup sugar and a pinch of salt until the apples are evenly coated.

  7. 7

    Press half of the flour-butter mixture firmly into the bottom of an 8×8-inch baking dish, creating an even layer covering the entire base.

  8. 8

    Spread the apricot jam in a thin, even layer across the dough base using the back of a spoon, then arrange the sugared apple slices on top.

  9. 9

    In a small bowl, mix the chopped walnuts with the remaining 2 tablespoons sugar, then scatter this mixture evenly over the apples.

  10. 10

    Crumble the remaining flour-butter mixture by rubbing it between your fingers into pea-sized pieces, then distribute these pieces in an even layer over the walnuts.

  11. 11

    Place the baking dish in the preheated oven and bake until the top is golden brown and the filling is bubbling slightly at the edges, about 30–35 minutes.

  12. 12

    Remove the baking dish from the oven and set it on a wire rack or trivet to cool for at least 10 minutes before slicing and serving.

Tools you’ll need

  • 8×8-inch baking dish
  • medium mixing bowl
  • small mixing bowl
  • vegetable peeler
  • cutting board
  • sharp chef's knife
  • small spoon
  • rubber spatula or spoon
  • wire cooling rack or trivet
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.