Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Austrian Apple Strudel

Crispy phyllo pastry wrapped around spiced apples and raisins, baked until golden. A rustic Austrian classic that looks fancy but comes together in under 30 minutes.

Total time
28 min
Servings
6
Calories
198
Protein
2g
Austrian Apple Strudel
rusticcozyaustrianvegetariancrispyflakytenderweekend

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 375°F and wait until the indicator light or beep signals it has finished preheating, about 10 minutes.

  2. Step 2

    Peel each apple by scrubbing a vegetable peeler from top to bottom, rotating the apple until all skin is removed.

  3. Step 3

    Cut each peeled apple in half from top to bottom, then cut out the stem and seed core with a small knife, creating two flat-bottomed halves.

  4. Step 4

    Slice each apple half lengthwise into thin strips about 1/8-inch thick, like cutting bread, to create long slivers.

  5. Step 5

    Combine the sliced apples, raisins, cinnamon, and sugar in a bowl and toss with your hands or a spoon until every apple piece is coated.

  6. Step 6

    Place one phyllo sheet on a cutting board and brush the entire surface with melted butter using a pastry brush or the back of a spoon.

  7. Step 7

    Lay a second phyllo sheet on top of the buttered sheet and brush it with butter the same way, repeating until you have stacked and buttered all 8 sheets.

  8. Step 8

    Spoon the apple filling onto the buttered phyllo stack, spreading it in a line about 2 inches from the edge closest to you, leaving 1-inch borders on the sides.

  9. Step 9

    Fold the bottom edge of phyllo up and over the filling, then roll the bundle away from you, tucking the sides in as you go to create a sealed log.

  10. Step 10

    Slide the rolled strudel onto a parchment-lined baking sheet with the seam facing down, then brush the entire top surface with the remaining melted butter.

  11. Step 11

    Place the baking sheet in the preheated oven and bake until the phyllo turns golden brown and the edges look darker, about 18–20 minutes.

  12. Step 12

    Remove the baking sheet from the oven using oven mitts and let the strudel cool on the sheet for 5 minutes so the filling sets before slicing.

  13. Step 13

    Cut the strudel crosswise into 6 equal pieces using a serrated knife with a gentle sawing motion to avoid crushing the crispy layers.

Tools you’ll need

  • vegetable peeler
  • cutting board
  • small sharp knife
  • mixing bowl
  • pastry brush
  • parchment-lined baking sheet
  • oven mitts
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.