Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Hungarian Cheese Pogácsa

Tender, flaky savory pastries filled with sharp cheese and caraway seeds. These crispy-edged Hungarian classics are perfect warm from the oven as a snack or appetizer.

Total time
35 min
Servings
12
Calories
248
Protein
8g
Hungarian Cheese Pogácsa
rusticeleganthungarianvegetariancheesecrispyflakytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 400°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. Step 2

    Pour the flour and salt into a large bowl and stir with a fork until mixed evenly.

  3. Step 3

    Add the cubed cold butter to the flour and use your fingertips to rub the butter into the flour until the mixture looks like coarse breadcrumbs with some pea-sized butter pieces still visible.

  4. Step 4

    Stir the grated cheese and caraway seeds into the flour mixture until evenly distributed.

  5. Step 5

    Pour the sour cream into the bowl and stir with a fork until a soft dough forms with no dry flour visible.

  6. Step 6

    Divide the dough into 12 equal pieces by pinching off golf-ball-sized portions and rolling each between your palms into a smooth ball.

  7. Step 7

    Place each ball on a parchment-lined baking sheet, spacing them about 2 inches apart so they have room to puff.

  8. Step 8

    Slide the baking sheet into the preheated 400°F oven and bake until the pogácsa are golden brown on top and a wooden toothpick inserted into the center comes out with no wet dough clinging to it, about 18–20 minutes.

  9. Step 9

    Remove the baking sheet from the oven and let the pogácsa cool on the pan for 5 minutes before transferring to a wire rack to cool slightly before serving.

Tools you’ll need

  • oven
  • large mixing bowl
  • fork
  • parchment paper
  • baking sheet
  • wooden toothpick
  • wire rack

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.