Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Hungarian Paprikás Krumpli

Tender potatoes and onions braised in a rich paprika sauce, finished with sour cream. A warming Hungarian classic that tastes like comfort in a bowl.

Total time
25 min
Servings
4
Calories
285
Protein
6g
Hungarian Paprikás Krumpli
comfortwholesomehungarianvegetarianvegetariantendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut the potatoes into 1-inch cubes by first cutting them lengthwise into thin slabs, then into sticks, then crosswise into cubes about the size of dice. Place the cut potatoes in a bowl of cold water.

  2. Step 2

    Cut the onion in half from root to tip, then place each half flat-side down. Slice each half crosswise into thin half-moon pieces, about 1/4-inch thick.

  3. Step 3

    Heat the olive oil in a large heavy-bottomed pot or deep skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 1 minute.

  4. Step 4

    Add the sliced onions to the hot oil and stir with a wooden spoon every 20 seconds until the onions turn soft and golden, about 3 minutes.

  5. Step 5

    Stir the paprika into the onions for 30 seconds until it becomes very fragrant and coats all the onion pieces, so it doesn't scorch.

  6. Step 6

    Drain the potatoes in a colander and add them to the pot, stirring once to mix with the paprika and onions.

  7. Step 7

    Pour in the vegetable broth—the liquid should cover the potatoes by about 1 inch. Stir once, then bring to a boil over medium-high heat.

  8. Step 8

    Once the broth boils vigorously, reduce heat to medium-low and cover with a lid. Simmer undisturbed for 12–15 minutes until the potatoes are easily pierced with a fork but still hold their shape.

  9. Step 9

    Remove the pot from the heat and stir in the sour cream until it is fully blended and no white streaks remain, about 20 seconds.

Tools you’ll need

  • cutting board
  • large chef's knife
  • colander
  • large heavy-bottomed pot or deep skillet with a lid
  • wooden spoon
  • tongs or serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.