Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Ikan Bakar with Sambal & Sides

Whole grilled fish brushed with spiced sambal, cooked alongside crispy tofu and tempeh on one sheet pan. Serve with steamed rice, fresh cucumbers, and extra sambal for a complete Indonesian dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
38g
Sheet-Pan Ikan Bakar with Sambal & Sides
comfortfreshindonesianfishcrispytenderweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish dry inside and out with paper towels. Score the skin 3 times on each side.

  2. Step 2

    Mix sambal with lime juice and 1 tbsp oil. Brush generously inside and outside the fish.

  3. Step 3

    Arrange fish, tofu cubes, and tempeh strips on a sheet pan. Drizzle remaining oil over tofu and tempeh. Season with salt and pepper.

  4. Step 4

    Broil 6 inches from heat for 12–14 minutes until fish skin crisps and flesh flakes easily at the thickest part.

  5. Step 5

    Divide rice among plates. Top with fish, tofu, tempeh, and cucumber slices.

  6. Step 6

    Serve with extra sambal and lime wedges on the side.

Tools you’ll need

  • sheet pan (18×13 inch)
  • oven broiler
  • paper towels
  • knife
  • small bowl
  • kitchen tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.