Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Iskender Kebab with Butter & Yogurt

Crispy-edged ground beef on pita, smothered in warm tomato sauce, melted butter, and cool yogurt. Grilled tomato on the side makes it complete.

Total time
20 min
Servings
2
Calories
520
Protein
28g
20-Min Iskender Kebab with Butter & Yogurt
comfortsatisfyingturkishbeefcrispycreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp butter in a skillet over medium-high. Brown ground beef, breaking it into small pieces, until no pink remains, about 6 minutes.

  2. Step 2

    Warm crushed tomato in a small pan, stirring occasionally, until it starts to bubble, about 3 minutes.

  3. Step 3

    Toast pita bread directly over a burner flame or in a dry skillet until warm and lightly charred, 1 minute per side.

  4. Step 4

    Slice tomato into thick rounds. Sear in the same skillet (oil or butter as needed) until soft and caramelized, 2 minutes per side.

  5. Step 5

    Place pita on a plate. Layer beef on top, then pour warm tomato sauce over it. Dollop yogurt on the side.

  6. Step 6

    Melt remaining 2 tbsp butter in a small pan, then drizzle over the yogurt and beef. Serve with grilled tomato.

Tools you’ll need

  • 12-inch skillet or larger
  • small saucepan
  • wooden spoon
  • kitchen tongs
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.