CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Garlic Beef Ribs with Smashed Potatoes

Seared beef ribs glazed with garlic, butter, and a touch of hot sauce—inspired by Brazilian costela but ready in 20 minutes. Served with creamy mashed potatoes and crispy pan bits for a weeknight dinner that tastes way more involved than it is.

Total time
20 min
Servings
2
Calories
620
Protein
48g
20-Min Garlic Beef Ribs with Smashed Potatoes
comfortsatisfyingbrazilianbeefcrispytendercreamyweeknight

Ingredients

  • 1.25 lb beef short ribs
  • 1 lb russet potatoes
  • 5 cloves garlic cloves, minced
  • 3 tbsp butter
  • 1 tbsp hot sauce (like Tabasco or sriracha)
  • ½ lime fresh lime

Instructions

  1. 1

    Cut potatoes into 1-inch chunks. Boil in salted water until fork-tender, about 12 minutes.

  2. 2

    Pat beef ribs dry with paper towels. Season generously with salt and black pepper on both sides.

  3. 3

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, about 90 seconds.

  4. 4

    Sear ribs 3 minutes per side without moving until edges are deeply browned. Transfer to a plate.

  5. 5

    Reduce heat to medium. Add butter and garlic to the pan; cook 60 seconds until fragrant, stirring.

  6. 6

    Return ribs to pan. Add hot sauce, toss to coat, and heat through for 90 seconds.

  7. 7

    Drain potatoes and mash with 2 tbsp butter, salt, and pepper until smooth and creamy.

  8. 8

    Serve ribs with pan juices over mashed potatoes. Squeeze lime juice over everything.

Tools you’ll need

  • large skillet (12-inch)
  • pot (for boiling potatoes)
  • paper towels
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.