Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Garlic Beef Ribs with Smashed Potatoes

Seared beef ribs glazed with garlic, butter, and a touch of hot sauce—inspired by Brazilian costela but ready in 20 minutes. Served with creamy mashed potatoes and crispy pan bits for a weeknight dinner that tastes way more involved than it is.

Total time
20 min
Servings
2
Calories
620
Protein
48g
20-Min Garlic Beef Ribs with Smashed Potatoes
comfortsatisfyingbrazilianbeefcrispytendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 1-inch chunks. Boil in salted water until fork-tender, about 12 minutes.

  2. Step 2

    Pat beef ribs dry with paper towels. Season generously with salt and black pepper on both sides.

  3. Step 3

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, about 90 seconds.

  4. Step 4

    Sear ribs 3 minutes per side without moving until edges are deeply browned. Transfer to a plate.

  5. Step 5

    Reduce heat to medium. Add butter and garlic to the pan; cook 60 seconds until fragrant, stirring.

  6. Step 6

    Return ribs to pan. Add hot sauce, toss to coat, and heat through for 90 seconds.

  7. Step 7

    Drain potatoes and mash with 2 tbsp butter, salt, and pepper until smooth and creamy.

  8. Step 8

    Serve ribs with pan juices over mashed potatoes. Squeeze lime juice over everything.

Tools you’ll need

  • large skillet (12-inch)
  • pot (for boiling potatoes)
  • paper towels
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.