Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Italian Pasta Salad with Chickpeas & Herbs

A vibrant cold pasta salad loaded with chickpeas, fresh vegetables, and a bright lemon-herb dressing. Perfect for meal prep, picnics, or a light dinner that tastes better the next day.

Total time
25 min
Servings
4
Calories
480
Protein
16g
Italian Pasta Salad with Chickpeas & Herbs
freshlightsimpleitalianmediterraneanvegetarianchickpeastender

Ingredients

11 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve the cherry tomatoes. Dice the cucumber into 1/2-inch chunks.

  2. Step 2

    Dice the bell pepper and red onion into 1/4-inch pieces.

  3. Step 3

    Juice both lemons into a small bowl. Whisk in 5 tbsp olive oil, salt, and pepper.

  4. Step 4

    Boil pasta in salted water until al dente, ~9 minutes. Drain and rinse with cold water.

  5. Step 5

    Transfer cooled pasta to a large bowl. Add chickpeas, tomatoes, cucumber, bell pepper, and red onion.

  6. Step 6

    Pour dressing over salad. Toss until everything is coated and evenly distributed.

  7. Step 7

    Fold in 3/4 cup fresh herbs. Top with shaved Parmesan and remaining herbs.

  8. Step 8

    Refrigerate at least 30 minutes before serving. Flavors deepen after 2+ hours.

Tools you’ll need

  • large pot
  • colander
  • large mixing bowl
  • small bowl
  • whisk
  • cutting board
  • knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.