Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kake Soba

A warm Japanese buckwheat noodle soup topped with a savory egg ribbon and green onions. Ready in 20 minutes with just six ingredients and one pot.

Total time
20 min
Servings
2
Calories
310
Protein
12g
Kake Soba
comfortlightjapanesevegetarianeggstendersilkyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the green onions crosswise into thin rings about 1/8 inch wide, keeping the white and green parts separate in two piles on the cutting board.

  2. Step 2

    Crack the 2 eggs into a small bowl and whisk them together with a fork until the yolks and whites are fully combined and uniform in color.

  3. Step 3

    Pour 4 cups of water into a large pot and bring it to a rolling boil over high heat, about 5 minutes — the water will bubble vigorously across the entire surface.

  4. Step 4

    Carefully add the 6 ounces of dried soba noodles to the boiling water and stir with a wooden spoon so they don't stick together, then return to a boil.

  5. Step 5

    Cook the noodles for 4 minutes until they are tender but still slightly firm when you bite one, stirring occasionally to prevent sticking.

  6. Step 6

    Stir in 3 tablespoons of soy sauce and 1 tablespoon of mirin, tasting a small spoonful to check if the broth tastes savory and slightly sweet.

  7. Step 7

    Slowly pour the beaten egg into the simmering broth while stirring gently in a circular motion so the egg forms thin ribbons throughout the soup, about 20 seconds.

  8. Step 8

    Remove the pot from heat and pour the noodles and broth into two deep bowls, dividing them equally.

  9. Step 9

    Scatter the white parts of the green onions over each bowl, then top with the green parts for a pop of color and mild onion flavor.

Tools you’ll need

  • large pot (3-quart or larger)
  • wooden spoon
  • small bowl
  • fork
  • cutting board
  • chef's knife
  • two deep soup bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.