Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Käsekuchen Skillet

German cheese cake meets dinner: a custardy, golden skillet bake with quark, eggs, and a buttery crust, ready in 20 minutes. Tangy, rich, and surprisingly savory.

Total time
22 min
Servings
4
Calories
285
Protein
14g
Käsekuchen Skillet
comfortsimplegermanvegetarianeggscheesecreamyfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F (190°C). Rub a 10-inch cast-iron skillet with 1 tbsp butter.

  2. Step 2

    Whisk eggs with sugar and lemon zest until pale and thick, about 2 minutes.

  3. Step 3

    Fold quark and cornstarch into eggs until just combined—don't overmix.

  4. Step 4

    Pour mixture into the buttered skillet. Dot the top with remaining 2 tbsp butter.

  5. Step 5

    Bake until the top is golden brown and the center jiggles only slightly, 12–14 minutes.

  6. Step 6

    Let rest 2 minutes. Serve warm, cut into wedges.

Tools you’ll need

  • 10-inch cast-iron skillet or 9x9-inch baking dish
  • mixing bowl
  • whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.