Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Garlic & Mushroom Potato Bake

Thinly sliced potatoes baked with roasted garlic, mushrooms, and cream in one skillet until golden and tender. Pure comfort food that feels fancy but takes just 25 minutes.

Total time
25 min
Servings
4
Calories
285
Protein
6g
Creamy Garlic & Mushroom Potato Bake
comfortsimpleeuropeanvegetariancreamytenderweeknightcozy

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F and lightly oil a 10-inch skillet.

  2. Step 2

    Slice potatoes into 1/8-inch rounds, then chop mushrooms and mince garlic.

  3. Step 3

    Layer half the potatoes in the skillet, then scatter half the mushrooms and garlic over them.

  4. Step 4

    Add the remaining potatoes, mushrooms, and garlic in a final layer.

  5. Step 5

    Pour cream over potatoes, season with salt and pepper, bake uncovered until tender and golden, ~20–22 min.

  6. Step 6

    Let rest 2 minutes, then serve straight from the skillet.

Tools you’ll need

  • 10-inch skillet or cast-iron pan
  • oven
  • sharp knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.