Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kaymak Toast with Balkan Sides

Creamy, rich kaymak spread on warm toast, served with fresh tomatoes, cucumbers, olives, and tea. A simple Balkan breakfast or light dinner that feels elegant but takes just minutes.

Total time
15 min
Servings
2
Calories
340
Protein
8g
Kaymak Toast with Balkan Sides
simpleelegantbalkanvegetariancreamycrispyweeknightbrunch

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast the bread until golden and crispy, about 2–3 minutes per side.

  2. Step 2

    Slice the tomatoes and cucumber into 1/4-inch rounds.

  3. Step 3

    Spread a generous layer of kaymak onto each warm toast slice.

  4. Step 4

    Arrange tomato slices, cucumber rounds, and olives on a plate alongside the toast.

  5. Step 5

    Serve immediately with a cup of hot tea.

Tools you’ll need

  • toaster or toaster oven
  • cutting board
  • serrated knife
  • butter knife
  • plate
  • kettle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.