CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Kaymak Toast with Balkan Sides

Creamy, rich kaymak spread on warm toast, served with fresh tomatoes, cucumbers, olives, and tea. A simple Balkan breakfast or light dinner that feels elegant but takes just minutes.

Total time
15 min
Servings
2
Calories
340
Protein
8g
Kaymak Toast with Balkan Sides
simpleelegantbalkanvegetariancreamycrispyweeknightbrunch

Ingredients

  • ½ cup kaymak (or clotted cream)
  • 4 slices bread (sourdough or crusty white)
  • 2 medium tomatoes
  • 1 medium cucumber
  • ½ cup black olives (pitted)
  • 2 cups tea (brewed, hot)

Instructions

  1. 1

    Toast the bread until golden and crispy, about 2–3 minutes per side.

  2. 2

    Slice the tomatoes and cucumber into 1/4-inch rounds.

  3. 3

    Spread a generous layer of kaymak onto each warm toast slice.

  4. 4

    Arrange tomato slices, cucumber rounds, and olives on a plate alongside the toast.

  5. 5

    Serve immediately with a cup of hot tea.

Tools you’ll need

  • toaster or toaster oven
  • cutting board
  • serrated knife
  • butter knife
  • plate
  • kettle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.