Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Burrata Cloud Toast with Avocado

Whipped burrata creates a pillowy cloud on crispy sourdough, topped with creamy avocado, bright citrus, and crispy breadcrumbs. A stunning 15-minute meal that looks restaurant-worthy.

Total time
15 min
Servings
2
Calories
512
Protein
14g
Burrata Cloud Toast with Avocado
elegantlightitalianvegetariancheesecreamycrispyfluffy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut burrata into chunks and place in a bowl. Drizzle with 1 tbsp olive oil and let soften 3 minutes.

  2. Step 2

    Scoop avocado flesh into a separate bowl. Squeeze lemon juice over it and mash roughly with a fork.

  3. Step 3

    Heat 1 tbsp olive oil in a skillet over medium-high until shimmering, about 1 minute.

  4. Step 4

    Toast breadcrumbs in the skillet, stirring constantly, until golden and fragrant, 2-3 minutes. Transfer to a plate.

  5. Step 5

    Add remaining 1 tbsp oil to the skillet. Lay sourdough slices flat and cook until edges crisp and surface turns golden, 2 minutes per side.

  6. Step 6

    Whip softened burrata with a fork until it reaches a soft, cloud-like consistency, about 1 minute.

  7. Step 7

    Spread whipped burrata generously over each toast slice while still warm from the skillet.

  8. Step 8

    Top with mashed avocado, keeping it rustic and peaked. Sprinkle toasted breadcrumbs, sea salt, and red pepper flakes over the top.

  9. Step 9

    Serve immediately while toast is still warm and burrata is pillowy.

Tools you’ll need

  • 2 small mixing bowls
  • fork
  • 12-inch skillet
  • wooden spoon or spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.