Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Seared Kielbasa with Cabbage & Mustard

Polish-style kielbasa seared until golden and served with buttery braised cabbage and a sharp mustard finish. One skillet, 20 minutes, pure comfort.

Total time
20 min
Servings
4
Calories
520
Protein
28g
Pan-Seared Kielbasa with Cabbage & Mustard
comfortcasualpolishporkcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a large skillet over medium-high heat. Working in batches, sear kielbasa rounds 2 minutes per side until golden and crispy. Set aside on a plate.

  2. Step 2

    Reduce heat to medium. Add butter and sauté onion until softened, about 3 minutes, stirring occasionally.

  3. Step 3

    Add cabbage and caraway seeds. Season with salt and pepper. Cook uncovered, stirring every 2 minutes, until cabbage is tender, about 6 minutes.

  4. Step 4

    Return kielbasa to the skillet. Stir in mustard until everything is coated and warmed through, about 90 seconds.

  5. Step 5

    Serve hot straight from the skillet with crusty bread if desired.

Tools you’ll need

  • 12-inch skillet or larger
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.