Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Seared Kielbasa with Caramelized Onions

Sliced kielbasa crisps in a hot skillet while onions soften and turn golden. Serve with mustard and crusty bread for an authentic Polish-inspired weeknight dinner.

Total time
25 min
Servings
4
Calories
385
Protein
22g
Pan-Seared Kielbasa with Caramelized Onions
comfortcasualpolishporkcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice kielbasa into 0.5-inch thick rounds. Cut onions in half, then slice into 0.25-inch-wide wedges.

  2. Step 2

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Add kielbasa rounds in a single layer. Sear 3 minutes until edges crisp and edges darken, then flip and cook another 2 minutes.

  4. Step 4

    Transfer kielbasa to a plate. Keep heat at medium, add onions and salt to the skillet.

  5. Step 5

    Cook onions, stirring occasionally, until soft and golden brown, about 8 minutes. You'll smell sweet caramel notes.

  6. Step 6

    Return kielbasa to the skillet, toss with onions, and cook 1 minute until heated through. Taste and adjust seasoning.

  7. Step 7

    Divide kielbasa and onions among plates. Serve with a dollop of whole-grain mustard on the side.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife
  • wooden spoon
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.