Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Kielbasa Veggie Skillet

Sliced kielbasa and frozen mixed veggies sear together in one skillet with garlic powder for a quick, satisfying dinner. Ready in under 20 minutes with zero fuss.

Total time
18 min
Servings
4
Calories
385
Protein
22g
20-Min Kielbasa Veggie Skillet
quicksatisfyingamericanporkcrispytenderweeknightmain-dish

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice kielbasa into 1/4-inch rounds.

  2. Step 2

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  3. Step 3

    Add kielbasa and sear 3 minutes until edges brown, stirring once halfway through.

  4. Step 4

    Stir in frozen vegetables and garlic powder, then cook 5 minutes until heated through.

  5. Step 5

    Season with salt and pepper to taste, then serve hot.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.