CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Skillet Kielbasa & Potatoes

Sliced kielbasa and diced potatoes sear together in one skillet with paprika for a smoky, satisfying weeknight dinner. Ready in under 20 minutes with minimal cleanup.

Total time
18 min
Servings
2
Calories
520
Protein
28g
Skillet Kielbasa & Potatoes
comfortquickamericanporkcrispytenderweeknightmain-dish

Ingredients

  • 1 lb kielbasa sausage
  • 1.5 lbs potatoes, diced into 0.5-inch cubes
  • 2 tbsp olive oil
  • 1 tsp paprika

Instructions

  1. 1

    Slice kielbasa into 0.5-inch rounds.

  2. 2

    Heat olive oil in a 12-inch skillet over medium-high until shimmering.

  3. 3

    Add diced potatoes and cook without stirring for 5 minutes until bottoms turn golden.

  4. 4

    Stir in kielbasa slices and paprika, then cook 4 minutes until edges crisp.

  5. 5

    Season with salt and pepper to taste.

  6. 6

    Serve hot directly from the skillet.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.