Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Skillet Kielbasa & Potatoes

Sliced kielbasa and diced potatoes sear together in one skillet with paprika for a smoky, satisfying weeknight dinner. Ready in under 20 minutes with minimal cleanup.

Total time
18 min
Servings
2
Calories
520
Protein
28g
Skillet Kielbasa & Potatoes
comfortquickamericanporkcrispytenderweeknightmain-dish

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice kielbasa into 0.5-inch rounds.

  2. Step 2

    Heat olive oil in a 12-inch skillet over medium-high until shimmering.

  3. Step 3

    Add diced potatoes and cook without stirring for 5 minutes until bottoms turn golden.

  4. Step 4

    Stir in kielbasa slices and paprika, then cook 4 minutes until edges crisp.

  5. Step 5

    Season with salt and pepper to taste.

  6. Step 6

    Serve hot directly from the skillet.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.