Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kiriboshi Daikon Stir-Fry

Tender-chewy dried daikon rehydrated and stir-fried with soy, mirin, and sesame in one pan. Nutty, umami-rich, and ready in under 15 minutes.

Total time
12 min
Servings
2
Calories
125
Protein
2g
Kiriboshi Daikon Stir-Fry
quickwholesomejapanesevegetarianvegandairy-freechewytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Soak kiriboshi daikon in warm water for 4 minutes until softened but still chewy.

  2. Step 2

    Drain daikon well. Julienne the carrot into thin matchsticks.

  3. Step 3

    Heat sesame oil in a large skillet over medium-high heat until shimmering, about 1 minute.

  4. Step 4

    Add daikon and carrot, stirring constantly until edges brown and char slightly, 3–4 minutes.

  5. Step 5

    Pour soy sauce and mirin over the vegetables and toss for 30 seconds until glossy.

  6. Step 6

    Transfer to a bowl and scatter sesame seeds on top. Serve warm.

Tools you’ll need

  • large skillet (10–12 inch)
  • small bowl for soaking
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.