Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Korean Twigim (Fried Mixed Bites)

Crispy fried strips of fish cake, potato, and mushroom tossed in a sweet-spicy gochujang glaze. Ready in 20 minutes—a TikTok-viral Korean street snack that tastes like a restaurant made it.

Total time
20 min
Servings
2
Calories
380
Protein
12g
Korean Twigim (Fried Mixed Bites)
casualindulgentkoreanfishcrispytenderweeknightcasual

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut fish cake into 3-inch sticks, then cut potato lengthwise into 1/4-inch fries. Halve mushrooms.

  2. Step 2

    Mix gochujang with 2 tbsp water and 1 tbsp sugar until smooth; set aside.

  3. Step 3

    Heat oil in a medium pot over medium-high until a chopstick dipped in sizzles immediately, ~3 minutes.

  4. Step 4

    Working in two batches, fry fish cake, potato, and mushrooms until golden and crispy, ~4 minutes per batch.

  5. Step 5

    Transfer all fried pieces to a bowl. Pour off most oil, leaving ~1 tbsp in the pot.

  6. Step 6

    Add gochujang glaze to pot, warm 30 seconds, then toss fried bites to coat. Serve immediately.

Tools you’ll need

  • cutting board
  • chef's knife
  • medium pot or deep skillet
  • cooking thermometer or chopstick
  • slotted spoon or wire strainer
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.