Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Krautfleckerl

A rustic Austrian noodle and sauerkraut bake with caramelized onions and crispy breadcrumb topping. Hearty, tangy, and deeply satisfying—comfort food at its finest.

Total time
35 min
Servings
4
Calories
385
Protein
12g
Krautfleckerl
comfortrusticaustrianvegetarianvegetariantendercrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat the oven to 375°F and wait until the indicator light or beep signals it has finished heating, about 10 minutes.

  2. Step 2

    Bring a large pot of salted water to a rolling boil over high heat, then add the egg noodles and stir with a wooden spoon.

  3. Step 3

    Cook the noodles, stirring once every 30 seconds, until they are tender but still have a slight firmness when you bite one, about 6 minutes.

  4. Step 4

    Drain the noodles in a colander, letting the water run through; do not rinse them.

  5. Step 5

    Place the onion on a cutting board with the root end pointing away from you, then slice it lengthwise from root to tip into 1/4-inch-thick slices.

  6. Step 6

    Separate the onion slices into individual rings by gently pulling them apart with your fingers.

  7. Step 7

    Place a 12-inch cast iron skillet over medium-high heat and add 2 tablespoons of butter; swirl the pan to coat the bottom evenly.

  8. Step 8

    When the butter stops foaming and smells nutty, add all the onion rings in a single layer, stirring gently with a wooden spoon.

  9. Step 9

    Cook the onions, stirring once every minute, until they are the color of golden caramel with the edges just beginning to brown, about 8 minutes. Do not rush—slow caramelization brings out sweetness.

  10. Step 10

    Sprinkle the 0.5 teaspoon caraway seeds over the onions and stir for 30 seconds until the seeds smell strongly fragrant.

  11. Step 11

    Add the drained sauerkraut and stir with the spoon to combine it evenly with the onions, breaking up any clumps.

  12. Step 12

    Pour the cooked noodles into the skillet and stir gently but thoroughly with a wooden spoon until the noodles, onions, and sauerkraut are fully mixed.

  13. Step 13

    In a small bowl, place the panko breadcrumbs and the remaining 1 tablespoon of butter; use a fork to mix them together until the breadcrumbs are evenly coated and look like damp sand.

  14. Step 14

    Sprinkle the buttered breadcrumbs evenly across the top of the noodle mixture in the skillet, covering the surface in a thin, even layer.

  15. Step 15

    Transfer the skillet to the preheated oven and bake, uncovered, until the breadcrumb topping is the color of warm honey with darker edges, about 12 minutes.

  16. Step 16

    Remove the skillet from the oven using oven mitts, then let it rest on a trivet or folded towel for 3 minutes before serving directly from the skillet.

Tools you’ll need

  • 12-inch cast iron skillet
  • large pot
  • colander
  • cutting board
  • chef's knife
  • wooden spoon
  • small bowl
  • fork
  • oven mitts
  • trivet or folded kitchen towel

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.