Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta & Herb Phyllo Pie

Buttery phyllo sheets layered with crumbly feta, fresh dill, and mint—baked until golden and shatteringly crisp. A weeknight Greek classic that tastes like you spent hours but takes 25 minutes.

Total time
25 min
Servings
4
Calories
385
Protein
14g
Crispy Feta & Herb Phyllo Pie
comfortelegantgreekvegetariancheesecrispyflakycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F. Whisk feta, dill, mint, eggs, lemon zest, and lemon juice in a bowl.

  2. Step 2

    Lay a phyllo sheet on a 9x13-inch baking pan. Brush lightly with melted butter.

  3. Step 3

    Layer 4 more phyllo sheets over the first, brushing each with butter before adding the next.

  4. Step 4

    Spread feta mixture evenly over phyllo, then top with 5 more phyllo sheets, brushing each with butter.

  5. Step 5

    Brush the top sheet generously with butter. Score the pie into squares with a sharp knife.

  6. Step 6

    Bake until golden brown and crispy, about 18–20 minutes. Cool 3 minutes before serving.

Tools you’ll need

  • 9x13-inch baking pan
  • medium mixing bowl
  • whisk
  • pastry brush
  • sharp knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.