Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lazy Lasagna

No-boil lasagna noodles layered with marinara, ricotta, and mozzarella, then baked until bubbly. Ready in under 20 minutes with zero fuss.

Total time
18 min
Servings
4
Calories
385
Protein
18g
Lazy Lasagna
comfortsimpleitalianvegetariancreamymeltyweeknightpasta

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 375°F.

  2. Step 2

    Spread a thin layer of marinara on the bottom of an 8x8-inch baking dish.

  3. Step 3

    Layer 3 noodles over sauce, then 1/3 ricotta, 1/3 mozzarella, and 1/3 remaining marinara.

  4. Step 4

    Repeat layers twice more, ending with mozzarella on top.

  5. Step 5

    Bake uncovered until bubbling at edges and cheese is golden, 12–14 minutes.

  6. Step 6

    Let rest 2 minutes, then serve.

Tools you’ll need

  • 8x8-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.