Custrd is out on the App Store — Download it free →
Back to recipes

Ravioli Lasagna Bake

Layered cheese ravioli with marinara and melted mozzarella, baked until bubbly in under 25 minutes. Serve with a side salad for a complete weeknight dinner.

Total time
25 min
Servings
4
Calories
485
Protein
22g
Ravioli Lasagna Bake
comforteasyitalianvegetariancreamymeltyweeknightpasta

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F and lightly oil a 9x13-inch baking dish.

  2. Step 2

    Spread 0.5 cups marinara on the dish bottom, then layer half the ravioli over it.

  3. Step 3

    Add 1 cup marinara and 1 cup mozzarella over the ravioli layer.

  4. Step 4

    Layer remaining ravioli, then top with remaining marinara and mozzarella.

  5. Step 5

    Bake uncovered for 15–18 minutes until cheese melts and edges bubble.

  6. Step 6

    Cool 2 minutes, then serve with green salad alongside.

Tools you’ll need

  • 9x13-inch baking dish
  • oven
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.