Custrd is out on the App Store — Download it free →
Back to recipes

Lemon Herb Grilled Chicken with Roasted Brussels Sprouts and Rice

Juicy lemon-herb chicken served over fluffy rice with caramelized Brussels sprouts and roasted red peppers, finished with briny capers and a fresh lemon wedge.

Total time
35 min
Servings
2
Calories
650
Protein
45g
Lemon Herb Grilled Chicken with Roasted Brussels Sprouts and Rice
comfortingfreshmediterraneangluten-freechickentendercrispyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Trim and halve the 1 lb Brussels sprouts, and slice the 1 red bell pepper into strips. Toss with 2 tbsp olive oil, salt, and pepper on a baking sheet.

  2. Step 2

    Roast the vegetables until browned and tender, about 20-25 minutes, shaking the pan halfway. Meanwhile, cook the 1 cup rice according to package directions.

  3. Step 3

    While vegetables roast, zest and juice the 1 lemon. In a small bowl, mix the zest, juice, 1 tsp oregano, 1 tbsp olive oil, salt, and pepper.

  4. Step 4

    Season the 2 chicken breasts with salt and pepper. Heat a grill or grill pan over medium-high; cook chicken until charred and cooked through, about 6-7 minutes per side.

  5. Step 5

    Brush the cooked chicken with the lemon-herb mixture. Let rest 5 minutes, then slice.

  6. Step 6

    Serve chicken over rice with roasted vegetables, sprinkle with 2 tbsp capers, and add a lemon wedge on the side.

Tools you’ll need

  • baking sheet
  • grill or grill pan
  • small bowl
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.