Back to recipes
Lemon Pepper Salmon
Buttery salmon fillets seasoned with lemon pepper and air-fried until flaky in under 15 minutes. A weeknight dinner that tastes restaurant-quality with zero fuss.
- Total time
- 15 min
- Servings
- 2
- Calories
- 245
- Protein
- 28g
simplefreshamericansalmontenderflakyweeknightmain-dish
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Pat salmon dry and place skin-side down on the air fryer tray.
Step 2
Divide butter between fillets and dot the tops evenly.
Step 3
Sprinkle lemon pepper seasoning generously over each fillet.
Step 4
Air fry at 380°F for 12 minutes until the surface looks opaque and flakes easily.
Step 5
Serve hot.
Tools you’ll need
- air fryer
- air fryer tray
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
