Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lemon Rice with Peas & Peanuts

Vibrant South Indian lemon rice — fragrant, tangy, and studded with roasted peanuts and peas. Ready in 15 minutes with cooked rice and a squeeze of citrus.

Total time
15 min
Servings
2
Calories
385
Protein
11g
Lemon Rice with Peas & Peanuts
freshsimpleindianvegetariandairy-freepeanutsfluffycrunchy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium heat until shimmering, about 1 minute.

  2. Step 2

    Add peanuts and toast 90 seconds until fragrant. Stir in turmeric and curry leaves, cook 30 seconds.

  3. Step 3

    Add frozen peas and stir for 1 minute until they begin to thaw and soften.

  4. Step 4

    Add cooked rice and break up any clumps with a spoon. Toss constantly for 2 minutes until heated through.

  5. Step 5

    Pour lemon juice over rice, season with salt and pepper to taste, toss well.

  6. Step 6

    Serve hot with fresh lemon wedges on the side.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • measuring cups
  • citrus juicer or fork

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.